{ ] "action" : "rerender" }, ', 'ajax'); { "actions" : [ "action" : "rerender" { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "action" : "rerender" }); "event" : "AcceptSolutionAction", // Oops, not the right sequence, lets restart from the top. "event" : "editProductMessage", "event" : "MessagesWidgetCommentForm", { }, { } { "dialogKey" : "dialogKey" "useTruncatedSubject" : "true", { } "}); "actions" : [ "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", "}); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" }, "context" : "envParam:entity", ] "parameters" : { //$(window).scroll(function() { "actions" : [ }, { "action" : "rerender" "actions" : [ { ;(function($) { "event" : "QuickReply", { "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'WIT12x5mHquOwuVbFYbgOallUSSxfHX-yXDP--uWzZo. "useCountToKudo" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/CallYa/thread-id/83892","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Cua5g205Zi2nX_Dwv1qDcwUsfUenn0ByI5dBoY39KzI. if ( !watching ) { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } "event" : "QuickReply", } { "event" : "markAsSpamWithoutRedirect", { }, "; }, ] } ;(function($) { { "action" : "rerender" { { "actions" : [ "context" : "envParam:feedbackData", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", { "messageViewOptions" : "1111110111111111111110111110100101001101" "disallowZeroCount" : "false", "event" : "addMessageUserEmailSubscription", Erfahren Sie hier, was Sie in diesem Fall tun können. "action" : "rerender" if (isNaN(val) ) } ] } LITHIUM.AjaxSupport.ComponentEvents.set({ { "event" : "RevokeSolutionAction", ], "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); ], } "actions" : [ "action" : "rerender" { "entity" : "189291", ] if ( !watching ) { LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "event" : "removeThreadUserEmailSubscription", "context" : "", }, "event" : "MessagesWidgetMessageEdit", watching = false; }, "truncateBody" : "true", "actions" : [ { { "actions" : [ "action" : "rerender" { "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "componentId" : "kudos.widget.button", "linkDisabled" : "false" }, "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "kudoEntity", "event" : "deleteMessage", } } }, } "quiltName" : "ForumMessage", "context" : "", { "context" : "", ] { "action" : "rerender" "action" : "rerender" { "event" : "AcceptSolutionAction", })(LITHIUM.jQuery); "actions" : [ } "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); }); } { LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { "truncateBodyRetainsHtml" : "false", }, }); { }, } "event" : "ProductAnswer", { LITHIUM.Dialog.options['1202340782'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" }); $('.lia-autocomplete-footer').append(ctaHTML); ] "selector" : "#messageview_9", }, { "context" : "lia-deleted-state", "disableLabelLinks" : "false", "useCountToKudo" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { }); { "event" : "kudoEntity", "context" : "envParam:quiltName,message", }, "actions" : [ "context" : "", ] }, } ', 'ajax'); { "context" : "", "action" : "rerender" ] "displaySubject" : "true", { } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); $(this).next().toggle(); ] } "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_53","feedbackSelector":".InfoMessage"}); "context" : "", "eventActions" : [ > 0) ) "action" : "rerender" { { "context" : "", "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":189307,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { }, } "action" : "rerender" } { { } "action" : "rerender" "event" : "MessagesWidgetEditAction", "action" : "rerender" "initiatorBinding" : true, return false; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ], LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-189299 .lia-rating-control-passive', '#form_0'); }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); } "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } } }); }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ ] { "actions" : [ "action" : "rerender" "actions" : [ "displaySubject" : "true", ] "context" : "", "displaySubject" : "true", { }, "action" : "addClassName" ], "actions" : [ ] { { { ] "actions" : [ "action" : "rerender" watching = false; "initiatorBinding" : true, } ] "context" : "envParam:quiltName", { { "action" : "rerender" "useTruncatedSubject" : "true", "defaultAriaLabel" : "", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "initiatorBinding" : true, "useSubjectIcons" : "true", }, } { "actions" : [ LITHIUM.Dialog({ "actions" : [ "eventActions" : [ ] } } "action" : "rerender" "actions" : [ ] ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/9741","ajaxErrorEventName":"LITHIUM:ajaxError","token":"qiBOcVAtvsnNGlNnsblA8vcxg7190UcQArWiIuPqd0c. ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { { "event" : "kudoEntity", "actions" : [ "componentId" : "kudos.widget.button", "action" : "addClassName" { }, "}); { "revokeMode" : "true", "disableLabelLinks" : "false", } }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); var position_x = msg.offset(); LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'MW46cPLQJpAqOY8qp8qo0-IXiW1ChjrWC29INlsVZNo. var handleOpen = function(event) { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { "action" : "rerender" "actions" : [ } { "context" : "", { "actions" : [ "event" : "MessagesWidgetCommentForm", logmein: [76, 79, 71, 77, 69, 73, 78], "event" : "markAsSpamWithoutRedirect", { "context" : "envParam:quiltName", } ] function disableInput(pagerId) { "actions" : [ } "action" : "pulsate" LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "addMessageUserEmailSubscription", "context" : "envParam:selectedMessage", "event" : "MessagesWidgetEditAnswerForm", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", }, }, }, "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" { { "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "RevokeSolutionAction", }, { return; LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2044598,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "kudosLinksDisabled" : "false", { "context" : "", "action" : "rerender" "actions" : [ ] "eventActions" : [ LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); { { ] "actions" : [ { LITHIUM.AjaxSupport.ComponentEvents.set({ } LITHIUM.InputEditForm("form_9", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "envParam:quiltName", "displaySubject" : "true", } "context" : "lia-deleted-state", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] { "entity" : "189303", else { "event" : "markAsSpamWithoutRedirect", } } { { // We made it! "actions" : [ { "action" : "rerender" "useCountToKudo" : "false", "event" : "MessagesWidgetEditAction", { }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233948}); o.innerHTML = ""; "event" : "editProductMessage", LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); ] }, { { ] } } ] "context" : "lia-deleted-state", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { ] "includeRepliesModerationState" : "false", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] "event" : "markAsSpamWithoutRedirect", "context" : "", }, "actions" : [ } "eventActions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_53","feedbackSelector":".InfoMessage"}); LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; LITHIUM.Dialog.options['-587805145'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:quiltName,expandedQuiltName", } ] "action" : "rerender" }, watching = false; { "actions" : [ }, "actions" : [ } $(document).ready(function(){ } ] }, { .attr('aria-expanded','true') { "context" : "envParam:quiltName,message", "context" : "", ] LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":189275}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":189299}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":189279}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":189287}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":189291}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":189299}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":189301}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":189303}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":189305}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":189307}},{"elementId":"link_53","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":189313}}]); "event" : "ProductAnswerComment", { "event" : "MessagesWidgetEditCommentForm", { { "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", "useCountToKudo" : "false", } ;(function($){ "action" : "rerender" { "displayStyle" : "horizontal", "context" : "", { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "context" : "", } "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? "event" : "removeThreadUserEmailSubscription", } { ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); var resetMenu = function() { }, LITHIUM.Dialog.options['-1673249247'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; //$('#lia-body').removeClass('lia-window-scroll'); { }(LITHIUM.jQuery)); "actions" : [ // Oops. } "actions" : [ "event" : "MessagesWidgetCommentForm", } "eventActions" : [ { "event" : "MessagesWidgetEditAnswerForm", { { "event" : "ProductAnswerComment", "initiatorBinding" : true, { LITHIUM.AjaxSupport.ComponentEvents.set({ // Set start to true only if the first key in the sequence is pressed "action" : "rerender" "action" : "rerender" count = 0; "initiatorBinding" : true, ] "context" : "", { }, { "action" : "rerender" "action" : "rerender" { "context" : "envParam:selectedMessage", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":189307,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }); setWarning(pagerId); "event" : "MessagesWidgetEditCommentForm", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { }, "action" : "rerender" "context" : "envParam:selectedMessage", "event" : "MessagesWidgetAnswerForm", "initiatorBinding" : true, ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "revokeMode" : "true", }, "context" : "envParam:quiltName,expandedQuiltName", ] { ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); "actions" : [ } ] "action" : "rerender" } "messageViewOptions" : "1111110111111111111110111110100101101101" "action" : "rerender" "actions" : [ "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", } { "action" : "rerender" } } "action" : "pulsate" { { "event" : "ProductMessageEdit", ] { "initiatorDataMatcher" : "data-lia-message-uid" }, } "dialogContentCssClass" : "lia-panel-dialog-content", { { ], { "useSimpleView" : "false", > 0) ) ], ] "forceSearchRequestParameterForBlurbBuilder" : "false", { "event" : "MessagesWidgetCommentForm", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; // We're good so far. }, "action" : "rerender" if (doChecks(pagerId, val)) "action" : "pulsate" } { { ] { ] }, "useSubjectIcons" : "true", "event" : "MessagesWidgetAnswerForm", LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'WIT12x5mHquOwuVbFYbgOallUSSxfHX-yXDP--uWzZo. ] { "actions" : [ "quiltName" : "ForumMessage", { } "accessibility" : false, { count++; "entity" : "189299", "event" : "editProductMessage", { "context" : "", "event" : "MessagesWidgetEditCommentForm", } "actions" : [ { }, ] "initiatorBinding" : true, "event" : "markAsSpamWithoutRedirect", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", { $(event.data.selector).removeClass('cssmenu-open'); "event" : "ProductAnswer", } { LITHIUM.Dialog.options['451756546'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); } "action" : "addClassName" "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? "selector" : "#kudosButtonV2_9", { "event" : "RevokeSolutionAction", "action" : "rerender" "selector" : "#messageview_9", "actions" : [ }, { { "context" : "", "event" : "approveMessage",